YPEL1 (NM_013313) Human Mass Spec Standard
CAT#: PH305359
YPEL1 MS Standard C13 and N15-labeled recombinant protein (NP_037445)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205359 |
Predicted MW | 13.6 kDa |
Protein Sequence |
>RC205359 protein sequence
Red=Cloning site Green=Tags(s) MVKMTKSKTFQAYLPNCHRTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTG LHAVADIYCENCKTTLGWKYEHAFESSQKYKEGKFIIELAHMIKDNGWE myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_037445 |
RefSeq Size | 4301 |
RefSeq ORF | 357 |
Synonyms | FKSG3 |
Locus ID | 29799 |
UniProt ID | O60688 |
Cytogenetics | 22q11.21-q11.22 |
Summary | This gene is located in the region associated with DiGeorge syndrome on chromosome 22. The encoded protein localizes to the centrosome and nucleolus and may play a role in the regulation of cell division. [provided by RefSeq, Feb 2015] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415624 | YPEL1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY415624 | Transient overexpression lysate of yippee-like 1 (Drosophila) (YPEL1) |
USD 436.00 |
|
TP305359 | Recombinant protein of human yippee-like 1 (Drosophila) (YPEL1), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review