C12orf43 (NM_022895) Human Mass Spec Standard

CAT#: PH304834

C12orf43 MS Standard C13 and N15-labeled recombinant protein (NP_075046)

Product Images

Coomassie blue staining of purified C12orf43 protein (Cat# TP304834). The protein was produced from HEK293T cells transfected with C12orf43 cDNA clone (Cat# RC204834) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204834
• Predicted MW: 28.3 kDa
• Protein Sequence:
  Sequence Link

  >RC204834 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAPSGTVSDSESSNSSSDAEELERCREAAMPAWGLEQRPHVAGKPRAGAANSQLSTSQPSLRHKVNEHE
  QDGNELQTTPEFRAHVAKKLGALLDSFITISEAAKEPAKAKVQKVALEDDGFRLFFTSVPGGREKEESPQ
  PRRKRQPSSSSSEDSDEEWRRCREAAVSASDILQESAIHSPGTVEKEAKKKRKLKKKAKKVASVDSAVAA
  TTPTSMATVQKQKSGELNGDQVSLGTKKKKKAKKASETSPFPPAKSATAIPAN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_075046
• RefSeq Size: 2548
• RefSeq ORF: 789
• Synonyms: Custos
• Locus ID: 64897
• UniProt ID: Q96C57, B4DWJ9
• Cytogenetics: 12q24.31
• Summary: Plays a role in the regulation of Wnt signaling pathway during early development.[UniProtKB/Swiss-Prot Function]