S100Z (NM_130772) Human Mass Spec Standard

CAT#: PH304754

S100Z MS Standard C13 and N15-labeled recombinant protein (NP_570128)

Product Images

Coomassie blue staining of purified S100Z protein (Cat# TP304754). The protein was produced from HEK293T cells transfected with S100Z cDNA clone (Cat# RC204754) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204754
• Predicted MW: 11.6 kDa
• Protein Sequence:
  Sequence Link

  >RC204754 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPTQLEMAMDTMIRIFHRYSGKARKRFKLSKGELKLLLQRELTEFLSCQKETQLVDKIVQDLDANKDNEV
  DFNEFVVMVAALTVACNDYFVEQLKKKGK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_570128
• RefSeq Size: 1164
• RefSeq ORF: 297
• Synonyms: Gm625; S100-zeta
• Locus ID: 170591
• UniProt ID: Q8WXG8
• Cytogenetics: 5q13.3
• Summary: Members of the S100 protein family contain 2 calcium-binding EF-hands and exhibit cell-type specific expression patterns. For additional background information on S100 proteins, see MIM 114085.[supplied by OMIM, Mar 2008]