ECHDC3 (NM_024693) Human Mass Spec Standard

CAT#: PH303685

ECHDC3 MS Standard C13 and N15-labeled recombinant protein (NP_078969)

Product Images

Coomassie blue staining of purified ECHDC3 protein (Cat# TP303685). The protein was produced from HEK293T cells transfected with ECHDC3 cDNA clone (Cat# RC203685) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203685
• Predicted MW: 32.7 kDa
• Protein Sequence:
  Sequence Link

  >RC203685 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAVAVLRAFGASGPMCLRRGPWAQLPARFCSRDPAGAGRRESEPRPTSARQLDGIRNIVLSNPKKRNTL
  SLAMLKSLQSDILHDADSNDLKVIIISAEGPVFSSGHDLKELTEEQGRDYHAEVFQTCSKVMMHIRNHPV
  PVIAMVNGLATAAGCQLVASCDIAVASDKSSFATPGVNVGLFCSTPGVALARAVPRKVALEMLFTGEPIS
  AQEALLHGLLSKVVPEAELQEETMRIARKIASLSRPVVSLGKATFYKQLPQDLGTAYYLTSQAMVDNLAL
  RDGQEGITAFLQKRKPVWSHEPV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_078969
• RefSeq Size: 1674
• RefSeq ORF: 909
• Locus ID: 79746
• UniProt ID: Q96DC8, A0A140VKF9
• Cytogenetics: 10p14
• Summary: May play a role in fatty acid biosynthesis and insulin sensitivity.[UniProtKB/Swiss-Prot Function]