UAP1 (NM_003115) Human Mass Spec Standard

CAT#: PH303494

UAP1 MS Standard C13 and N15-labeled recombinant protein (NP_003106)

Product Images

Coomassie blue staining of purified UAP1 protein (Cat# TP303494). The protein was produced from HEK293T cells transfected with UAP1 cDNA clone (Cat# RC203494) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203494
• Predicted MW: 57.1 kDa
• Protein Sequence:
  Sequence Link

  >RC203494 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNINDLKLTLSKAGQEHLLRFWNELEEAQQVELYAELQAMNFEELNFFFQKAIEGFNQSSYQKNVDARME
  PVPREVLGSATRDQDQLQAWESEGLFQISQNKVAVLLLAGGQGTRLGVAYPKGMYDVGLPSRKTLFQIQA
  ERILKLQQVAEKYYGNKCIIPWYIMTSGRTMESTKEFFTKHKYFGLKKENVIFFQQGMLPAMSFDGKIIL
  EEKNKVSMAPDGNGGLYRALAAQNIVEDMEQRGIWSIHVYCVDNILVKVADPRFIGFCIQKGADCGAKVV
  EKTNPTEPVGVVCRVDGVYQVVEYSEISLATAQKRSSDGRLLFNAGNIANHFFTVPFLRDVVNVYEPQLQ
  HHVAQKKIPYVDTQGQLIKPDKPNGIKMEKFVFDIFQFAKKFVVYEVLREDEFSPLKNADSQNGKDNPTT
  ARHALMSLHHCWVLNAGGHFIDENGSRLPAIPRLKDANDVPIQCEISPLISYAGEGLESYVADKEFHAPL
  IIDENGVHELVKNGI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003106
• RefSeq Size: 2344
• RefSeq ORF: 1515
• Synonyms: AGX; AGX1; AGX2; SPAG2
• Locus ID: 6675
• UniProt ID: Q16222, A0A140VKC0
• Cytogenetics: 1q23.3
• Summary: Converts UTP and GlcNAc-1-P into UDP-GlcNAc, and UTP and GalNAc-1-P into UDP-GalNAc. Isoform AGX1 has 2 to 3 times higher activity towards GalNAc-1-P, while isoform AGX2 has 8 times more activity towards GlcNAc-1-P.[UniProtKB/Swiss-Prot Function]
• Protein Pathways: Amino sugar and nucleotide sugar metabolism, Metabolic pathways