RAB25 (NM_020387) Human Mass Spec Standard

CAT#: PH303413

RAB25 MS Standard C13 and N15-labeled recombinant protein (NP_065120)

Product Images

Coomassie blue staining of purified RAB25 protein (Cat# TP303413). The protein was produced from HEK293T cells transfected with RAB25 cDNA clone (Cat# RC203413) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203413
• Predicted MW: 23.5 kDa
• Protein Sequence:
  Sequence Link

  >RC203413 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGNGTEEDYNFVFKVVLIGESGVGKTNLLSRFTRNEFSHDSRTTIGVEFSTRTVMLGTAAVKAQIWDTAG
  LERYRAITSAYYRGAVGALLVFDLTKHQTYAVVERWLKELYDHAEATIVVMLVGNKSDLSQAREVPTEEA
  RMFAENNGLLFLETSALDSTNVELAFETVLKEIFAKVSKQRQNSIRTNAITLGSAQAGQEPGPGEKRACC
  ISL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_065120
• RefSeq Size: 1101
• RefSeq ORF: 639
• Synonyms: CATX-8; RAB11C
• Locus ID: 57111
• UniProt ID: P57735
• Cytogenetics: 1q22
• Summary: The protein encoded by this gene is a member of the RAS superfamily of small GTPases. The encoded protein is involved in membrane trafficking and cell survival. This gene has been found to be a tumor suppressor and an oncogene, depending on the context. Two variants, one protein-coding and the other not, have been found for this gene. [provided by RefSeq, Nov 2015]
• Protein Families: Druggable Genome, Transcription Factors