ZC4H2 (NM_018684) Human Mass Spec Standard
CAT#: PH302589
ZC4H2 MS Standard C13 and N15-labeled recombinant protein (NP_061154)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202589 |
Predicted MW | 26.2 kDa |
Protein Sequence |
>RC202589 protein sequence
Red=Cloning site Green=Tags(s) MADEQEIMCKLESIKEIRNKTLQMEKIKARLKAEFEALESEERHLKEYKQEMDLLLQEKMAHVEELRLIH ADINVMENTIKQSENDLNKLLESTRRLHDEYKPLKEHVDALRMTLGLQRLPDLCEEEEKLSLDYFEKQKA EWQTEPQEPPIPESLAAAAAAAQQLQVARKQDTRQTATFRQQPPPMKACLSCHQQIHRNAPICPLCKAKS RSRNPKKPKRKQDE myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_061154 |
RefSeq Size | 2812 |
RefSeq ORF | 672 |
Synonyms | HCA127; KIAA1166; MCS; MRXS4; WRWF; WRWFFR; WWS |
Locus ID | 55906 |
UniProt ID | Q9NQZ6 |
Cytogenetics | Xq11.2 |
Summary | This gene encodes a member of the zinc finger domain-containing protein family. This family member has a C-terminal zinc finger domain that is characterized by four cysteine residues and two histidine residues, and it also includes a coiled-coil region. This protein has been detected as an autoantigen in hepatocellular carcinoma patients. This gene has been identified as a potential candidate for X-linked cognitive disability. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2011] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412985 | ZC4H2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC432640 | ZC4H2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY412985 | Transient overexpression lysate of zinc finger, C4H2 domain containing (ZC4H2) |
USD 436.00 |
|
LY432640 | Transient overexpression lysate of zinc finger, C4H2 domain containing (ZC4H2), transcript variant 3 |
USD 436.00 |
|
TP302589 | Recombinant protein of human zinc finger, C4H2 domain containing (ZC4H2), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review