ZC4H2 (NM_018684) Human Mass Spec Standard

CAT#: PH302589

ZC4H2 MS Standard C13 and N15-labeled recombinant protein (NP_061154)

Product Images

Coomassie blue staining of purified ZC4H2 protein (Cat# TP302589). The protein was produced from HEK293T cells transfected with ZC4H2 cDNA clone (Cat# RC202589) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202589
• Predicted MW: 26.2 kDa
• Protein Sequence:
  Sequence Link

  >RC202589 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MADEQEIMCKLESIKEIRNKTLQMEKIKARLKAEFEALESEERHLKEYKQEMDLLLQEKMAHVEELRLIH
  ADINVMENTIKQSENDLNKLLESTRRLHDEYKPLKEHVDALRMTLGLQRLPDLCEEEEKLSLDYFEKQKA
  EWQTEPQEPPIPESLAAAAAAAQQLQVARKQDTRQTATFRQQPPPMKACLSCHQQIHRNAPICPLCKAKS
  RSRNPKKPKRKQDE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_061154
• RefSeq Size: 2812
• RefSeq ORF: 672
• Synonyms: HCA127; KIAA1166; MCS; MRXS4; WRWF; WRWFFR; WWS
• Locus ID: 55906
• UniProt ID: Q9NQZ6
• Cytogenetics: Xq11.2
• Summary: This gene encodes a member of the zinc finger domain-containing protein family. This family member has a C-terminal zinc finger domain that is characterized by four cysteine residues and two histidine residues, and it also includes a coiled-coil region. This protein has been detected as an autoantigen in hepatocellular carcinoma patients. This gene has been identified as a potential candidate for X-linked cognitive disability. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2011]