VAT1 (NM_006373) Human Mass Spec Standard

CAT#: PH302201

VAT1 MS Standard C13 and N15-labeled recombinant protein (NP_006364)

Product Images

Coomassie blue staining of purified VAT1 protein (Cat# TP302201). The protein was produced from HEK293T cells transfected with VAT1 cDNA clone (Cat# RC202201) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202201
• Predicted MW: 41.9 kDa
• Protein Sequence:
  Sequence Link

  >RC202201 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSDEREVAEAATGEDASSPPPKTEAASDPQHPAASEGAAAAAASPPLLRCLVLTGFGGYDKVKLQSRPAA
  PPAPGPGQLTLRLRACGLNFADLMARQGLYDRLPPLPVTPGMEGAGVVIAVGEGVSDRKAGDRVMVLNRS
  GMWQEEVTVPSVQTFLIPEAMTFEEAAALLVNYITAYMVLFDFGNLQPGHSVLVHMAAGGVGMAAVQLCR
  TVENVTVFGTASASKHEALKENGVTHPIDYHTTDYVDEIKKISPKGVDIVMDPLGGSDTAKGYNLLKPMG
  KVVTYGMANLLTGPKRNLMALARTWWNQFSVTALQLLQANRAVCGFHLGYLDGEVELVSGVVARLLALYN
  QGHIKPHIDSVWPFEKVADAMKQMQEKKNVGKVLLVPGPEKEN
  
  SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006364
• RefSeq Size: 2758
• RefSeq ORF: 1179
• Synonyms: VATI
• Locus ID: 10493
• UniProt ID: Q99536, A0A024R1Z6
• Cytogenetics: 17q21.31
• Summary: Synaptic vesicles are responsible for regulating the storage and release of neurotransmitters in the nerve terminal. The protein encoded by this gene is an abundant integral membrane protein of cholinergic synaptic vesicles and is thought to be involved in vesicular transport. It belongs to the quinone oxidoreductase subfamily of zinc-containing alcohol dehydrogenase proteins. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome