OCIAD1 (NM_017830) Human Mass Spec Standard

CAT#: PH301506

OCIAD1 MS Standard C13 and N15-labeled recombinant protein (NP_060300)

Product Images

Coomassie blue staining of purified OCIAD1 protein (Cat# TP301506). The protein was produced from HEK293T cells transfected with OCIAD1 cDNA clone (Cat# RC201506) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201506
• Predicted MW: 27.6 kDa
• Protein Sequence:
  Sequence Link

  >RC201506 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNGRADFREPNAEVPRPIPHIGPDYIPTEEERRVFAECNDESFWFRSVPLAATSMLITQGLISKGILSSH
  PKYGSIPKLILACIMGYFAGKLSYVKTCQEKFKKLENSPLGEALRSGQARRSSPPGHYYQKSKYDSSVSG
  QSSFVTSPAADNIEMLPHYEPIPFSSSMNESAPTGITDHIVQGPDPNLEESPKRKNITYEELRNKNRESY
  EVSLTQKTDPSVRPMHERVPKKEVKVNKYGDTWDE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_060300
• RefSeq Size: 2005
• RefSeq ORF: 735
• Synonyms: ASRIJ; OCIA; TPA018
• Locus ID: 54940
• UniProt ID: Q9NX40, A0A024R9U3
• Cytogenetics: 4p11
• Summary: Maintains stem cell potency (By similarity). Increases STAT3 phosphorylation and controls ERK phosphorylation (By similarity). May act as a scaffold, increasing STAT3 recruitment onto endosomes (By similarity). Involved in integrin-mediated cancer cell adhesion and colony formation in ovarian cancer (PubMed:20515946).[UniProtKB/Swiss-Prot Function]