HAUS4 (NM_017815) Human Mass Spec Standard
CAT#: PH300173
HAUS4 MS Standard C13 and N15-labeled recombinant protein (NP_060285)
USD 436.00
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200173 |
Predicted MW | 42.4 kDa |
Protein Sequence |
>RC200173 protein sequence
Red=Cloning site Green=Tags(s) MASGDFCSPGEGMEILQQVCSKQLPPCNLSKEDLLQNPYFSKLLLNLSQHVDESGLSLTLAKEQAQAWKE VRLHKTTWLRSEILHRVIQELLVDYYVKIQDTNVTSEDKKFHETLEQRLLVTELMRLLGPSQEREIPPLL GLEKADLLELMPLSEDFVWMRARLQQEVEEQLKKKCFTLLCYYDPNSDADSETVKAAKVWKLAEVLVGEQ QQCQDAKSQQKEQMLLLEKKSAAYSQVLLRCLTLLQRLLQEHRLKTQSELDRINAQYLEVKCGAMILKLR MEELKILSDTYTVEKVEVHRLIRDRLEGAIHLQEQDMENSRQVLNSYEVLGEEFDRLVKEYTVLKQATEN KRWALQEFSKVYR myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_060285 |
RefSeq Size | 1649 |
RefSeq ORF | 1089 |
Synonyms | C14orf94 |
Locus ID | 54930 |
UniProt ID | Q9H6D7 |
Cytogenetics | 14q11.2 |
Summary | This gene encodes a subunit of the centrosome complex termed the human augmin complex. The encoded protein localizes to the spindle microtubules and may play a role in mitotic spindle assembly and maintenance of centrosome integrity during cell division. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 1. [provided by RefSeq, Oct 2009] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413524 | HAUS4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC432875 | HAUS4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC432946 | HAUS4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY413524 | Transient overexpression lysate of HAUS augmin-like complex, subunit 4 (HAUS4), transcript variant 2 |
USD 436.00 |
|
LY432875 | Transient overexpression lysate of HAUS augmin-like complex, subunit 4 (HAUS4), transcript variant 3 |
USD 436.00 |
|
LY432946 | Transient overexpression lysate of HAUS augmin-like complex, subunit 4 (HAUS4), transcript variant 1 |
USD 436.00 |
|
TP300173 | Recombinant protein of human chromosome 14 open reading frame 94 (C14orf94), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review