NCF4 (NM_000631) Human Tagged ORF Clone

CAT#: RC216094

NCF4 (Myc-DDK-tagged)-Human neutrophil cytosolic factor 4, 40kDa (NCF4), transcript variant 1

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro

AAV Particle: DDK


  "NM_000631" in other vectors (6)

Reconstitution Protocol

USD 457.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


NCF4 mouse monoclonal antibody, clone OTI4B5 (formerly 4B5)
    • 100 ul

USD 447.00

Other products for "NCF4"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol NCF4
Synonyms CGD3; NCF; P40PHOX; SH3PXD4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC216094 representing NM_000631
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGTGGCCCAGCAGCTGCGGGCCGAGAGTGACTTTGAACAGCTTCCGGATGATGTTGCCATCTCGG
CCAACATTGCTGACATCGAGGAGAAGAGAGGCTTCACCAGCCACTTTGTTTTCGTCATCGAGGTGAAGAC
AAAAGGAGGATCCAAGTACCTCATCTACCGCCGCTACCGCCAGTTCCATGCTTTGCAGAGCAAGCTGGAG
GAGCGCTTCGGGCCAGACAGCAAGAGCAGTGCCCTGGCCTGTACCCTGCCCACACTCCCAGCCAAAGTCT
ACGTGGGTGTGAAACAGGAGATCGCCGAGATGCGGATACCTGCCCTCAACGCCTACATGAAGAGCCTGCT
CAGCCTGCCGGTCTGGGTGCTGATGGATGAGGACGTCCGGATCTTCTTTTACCAGTCGCCCTATGACTCA
GAGCAGGTGCCCCAGGCACTCCGCCGGCTCCGCCCGCGCACCCGGAAAGTCAAGAGCGTGTCCCCACAGG
GCAACAGCGTTGACCGCATGGCAGCTCCGAGAGCAGAGGCTCTATTTGACTTCACTGGAAACAGCAAACT
GGAGCTGAATTTCAAAGCTGGAGATGTGATCTTCCTCCTCAGTCGGATCAACAAAGACTGGCTGGAGGGC
ACTGTCCGGGGAGCCACGGGCATCTTCCCTCTCTCCTTCGTGAAGATCCTCAAAGACTTCCCTGAGGAGG
ACGACCCCACCAACTGGCTGCGTTGCTACTACTACGAAGACACCATCAGCACCATCAAGGACATCGCGGT
GGAGGAAGATCTCAGCAGCACTCCCCTATTGAAAGACCTGCTGGAGCTCACAAGGCGGGAGTTCCAGAGA
GAGGACATAGCTCTGAATTACCGGGACGCTGAGGGGGATCTGGTTCGGCTGCTGTCGGATGAGGACGTAG
CGCTCATGGTGCGGCAGGCTCGTGGCCTCCCCTCCCAGAAGCGCCTCTTCCCCTGGAAGCTGCACATCAC
GCAGAAGGACAACTACAGGGTCTACAACACGATGCCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC216094 representing NM_000631
Red=Cloning site Green=Tags(s)

MAVAQQLRAESDFEQLPDDVAISANIADIEEKRGFTSHFVFVIEVKTKGGSKYLIYRRYRQFHALQSKLE
ERFGPDSKSSALACTLPTLPAKVYVGVKQEIAEMRIPALNAYMKSLLSLPVWVLMDEDVRIFFYQSPYDS
EQVPQALRRLRPRTRKVKSVSPQGNSVDRMAAPRAEALFDFTGNSKLELNFKAGDVIFLLSRINKDWLEG
TVRGATGIFPLSFVKILKDFPEEDDPTNWLRCYYYEDTISTIKDIAVEEDLSSTPLLKDLLELTRREFQR
EDIALNYRDAEGDLVRLLSDEDVALMVRQARGLPSQKRLFPWKLHITQKDNYRVYNTMP

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_000631
ORF Size 1017 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_000631.5
RefSeq Size 1386 bp
RefSeq ORF 1020 bp
Locus ID 4689
UniProt ID Q15080
Cytogenetics 22q12.3
Domains PB1, SH3, PX
Protein Pathways Leukocyte transendothelial migration
MW 38.9 kDa
Gene Summary The protein encoded by this gene is a cytosolic regulatory component of the superoxide-producing phagocyte NADPH-oxidase, a multicomponent enzyme system important for host defense. This protein is preferentially expressed in cells of myeloid lineage. It interacts primarily with neutrophil cytosolic factor 2 (NCF2/p67-phox) to form a complex with neutrophil cytosolic factor 1 (NCF1/p47-phox), which further interacts with the small G protein RAC1 and translocates to the membrane upon cell stimulation. This complex then activates flavocytochrome b, the membrane-integrated catalytic core of the enzyme system. The PX domain of this protein can bind phospholipid products of the PI(3) kinase, which suggests its role in PI(3) kinase-mediated signaling events. The phosphorylation of this protein was found to negatively regulate the enzyme activity. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.