Hsp22 (HSPB8) (NM_014365) Human Tagged ORF Clone

CAT#: RC201040

HSPB8 (Myc-DDK-tagged)-Human heat shock 22kDa protein 8 (HSPB8)

Product Images

Circular map for RC201040

• 

  HEK293T cells were transfected with the pCMV6-ENTRY control (Cat# PS100001, Left lane) or pCMV6-ENTRY HSPB8 (Cat# RC201040, Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-HSPB8 (Cat# TA501210). Positive lysates LY415329 (100ug) and LC415329 (20ug) can be purchased separately from OriGene.

• 

  Western blot validation of overexpression lysate (Cat# LY415329) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC201040 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified HSPB8 protein (Cat# TP301040). The protein was produced from HEK293T cells transfected with HSPB8 cDNA clone (Cat# RC201040) using MegaTran 2.0 (Cat# TT210002).

• 

  Anti-HSPB8 mouse monoclonal antibody (TA501210) immunofluorescent staining of COS7 cells transiently transfected by pCMV6-ENTRY HSPB8 (RC201040 ).

• 

  HEK293T cells transfected with either RC201040 overexpress plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-HSPB8 antibody (TA501210), and then analyzed by flow cytometry.

Show all 6 images

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Hsp22
• Synonyms: CMT2L; DHMN2; E2IG1; H11; HMN2; HMN2A; HSP22
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC201040 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCTGACGGTCAGATGCCCTTCTCCTGCCACTACCCAAGCCGCCTGCGCCGAGACCCCTTCCGGGACT
  CTCCCCTCTCCTCTCGCCTGCTGGATGATGGCTTTGGCATGGACCCCTTCCCAGACGACTTGACAGCCTC
  TTGGCCCGACTGGGCTCTGCCTCGTCTCTCCTCCGCCTGGCCAGGCACCCTAAGGTCGGGCATGGTGCCC
  CGGGGCCCCACTGCCACCGCCAGGTTTGGGGTGCCTGCCGAGGGCAGGACCCCCCCACCCTTCCCTGGGG
  AGCCCTGGAAAGTGTGTGTGAATGTGCACAGCTTCAAGCCAGAGGAGTTGATGGTGAAGACCAAAGATGG
  ATACGTGGAGGTGTCTGGCAAACATGAAGAGAAACAGCAAGAAGGTGGCATTGTTTCTAAGAACTTCACA
  AAGAAAATCCAGCTTCCTGCAGAGGTGGATCCTGTGACAGTATTTGCCTCACTTTCCCCAGAGGGTCTGC
  TGATCATCGAAGCTCCCCAGGTCCCTCCTTACTCAACATTTGGAGAGAGCAGTTTCAACAACGAGCTTCC
  CCAGGACAGCCAGGAAGTCACCTGTACC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC201040 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTLRSGMVP
  RGPTATARFGVPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFT
  KKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCT
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_014365
• ORF Size: 588 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_014365.3
• RefSeq Size: 2056 bp
• RefSeq ORF: 591 bp
• Locus ID: 26353
• UniProt ID: Q9UJY1
• Cytogenetics: 12q24.23
• Domains: HSP20
• Protein Families: Druggable Genome, Protein Kinase
• MW: 21.6 kDa
• Gene Summary: The protein encoded by this gene belongs to the superfamily of small heat-shock proteins containing a conservative alpha-crystallin domain at the C-terminal part of the molecule. The expression of this gene in induced by estrogen in estrogen receptor-positive breast cancer cells, and this protein also functions as a chaperone in association with Bag3, a stimulator of macroautophagy. Thus, this gene appears to be involved in regulation of cell proliferation, apoptosis, and carcinogenesis, and mutations in this gene have been associated with different neuromuscular diseases, including Charcot-Marie-Tooth disease. [provided by RefSeq, Jul 2008]