HFE Rabbit Polyclonal Antibody

CAT#: TA335234

Rabbit Polyclonal Anti-HFE Antibody

Product Images

WB Suggested Anti-HFE Antibody Titration: 0.2-1 ug/ml; Positive Control: Hela cell lysate;There is BioGPS gene expression data showing that HFE is expressed in HeLa

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HFE antibody: synthetic peptide directed towards the N terminal of human HFE. Synthetic peptide located within the following region: MGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWVSSRISSQMW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 40 kDa
• Gene Name: hemochromatosis
• Database Link:
  NP_000401
  Entrez Gene 3077 Human
  UniProt ID Q30201
• Background: HFE is a membrane protein that is similar to MHC class I-type proteins and associates with beta2-microglobulin (beta2M). It is thought that this protein functions to regulate iron absorption by regulating the interaction of the transferrin receptor with transferrin. The iron storage disorder, hereditary haemochromatosis, is a recessive genetic disorder that results from defects in its gene.
• Synonyms: HFE1; HH; HLA-H; MVCD7; TFQTL2
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 86%; Mouse: 86%; Rat: 79%; Bovine: 79%; Rabbit: 79%

Reference Data

• Protein Families: Druggable Genome, Transmembrane